PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009608121.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 203aa    MW: 23509.7 Da    PI: 8.4772
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009608121.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.4e-192174457
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    + ++++eq+++Lee F +++++  e++ +LAk+lg++ rq+ +W+qNrRa++k+
  XP_009608121.1 21 KKRLNQEQVKRLEESFDSTKKLEPEQKIQLAKELGVPPRQIAIWYQNRRARWKN 74
                    56799***********************************************95 PP

2HD-ZIP_I/II107.78.8e-3520111293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +k+rl++eqvk LEesF++++kLepe+K +la+eLg+ prq+a+W+qnrRAR+k++ lE dy+aL++++ +  +e++++eke+e+Lr elk+
  XP_009608121.1  20 NKKRLNQEQVKRLEESFDSTKKLEPEQKIQLAKELGVPPRQIAIWYQNRRARWKNQSLELDYNALQHKLGTALAEKRKIEKENERLRVELKK 111
                     79*************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.711575IPR001356Homeobox domain
SMARTSM003894.6E-151879IPR001356Homeobox domain
CDDcd000863.52E-142176No hitNo description
SuperFamilySSF466891.47E-172184IPR009057Homeodomain-like
PfamPF000463.4E-162174IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-192282IPR009057Homeodomain-like
PRINTSPR000314.0E-54655IPR000047Helix-turn-helix motif
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
PRINTSPR000314.0E-55571IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MNNFLNSQYL HKHQSILNHN KKRLNQEQVK RLEESFDSTK KLEPEQKIQL AKELGVPPRQ  60
IAIWYQNRRA RWKNQSLELD YNALQHKLGT ALAEKRKIEK ENERLRVELK KLNEMLVACK  120
KAQGHEETQG LIPLIAANSI SSGCEEVVVS SSFQEDVSCS LVKNNSESNL QFDELYACLM  180
GAEEGSNCRL SWQNGKDLWV WKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608121.11e-147PREDICTED: homeobox-leucine zipper protein ATHB-52-like
TrEMBLM1BWX47e-98M1BWX4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000548182e-97(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27152453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.13e-28homeobox protein 52